Pfam domain
Pfam family: Forkhead (PF00250.17)
Uniprot AC: O15353
RecName: Forkhead box protein N1
Begin-End: 270-357
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
PKPIYSYSILIFMALKNSKTGSLPVSEIYNFMTEHFPYFKTAPDGWKNSVRHNLSLNKCF
EKVENKSGSSSRKGCLWALNPAKIDKMQ
Structures of the domain O15353 270-357
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6el8 X-ray 1.61 A 271-356  H-Bb H-Mj S-Bb L-Bb 
6el8 X-ray 1.61 D 271-356  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2020

text