Pfam domain
Pfam family: Forkhead (PF00250.17)
Uniprot AC: O15409
RecName: Forkhead box protein P2
Begin-End: 503-584
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
VRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKCF
VRVENVKGAVWTVDEVEYQKRR
Structures of the domain O15409 503-584
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2a07 X-ray 1.9 K 504-580  H-Bb H-Mj S-Bb L-Bb 
2a07 X-ray 1.9 F 504-580  H-Bb H-Mj L-Bb L-Mj 
2a07 X-ray 1.9 G 506-580  H-Bb 
2a07 X-ray 1.9 H 506-580  H-Bb 
2a07 X-ray 1.9 I 504-579  H-Bb H-Mj L-Bb L-Mj 
2a07 X-ray 1.9 J 504-580  H-Bb H-Mj S-Bb L-Bb 
2as5 X-ray 2.7 F 504-580  H-Bb H-Mj S-Bb 
2as5 X-ray 2.7 G 504-580  H-Bb H-Mj S-Bb 


© NPIDB team 2003 - 2020

text