Pfam domain
Pfam family: RNA_pol_Rpb4 (PF03874.15)
Uniprot AC: O15514
RecName: DNA-directed RNA polymerase II subunit RPB4
Begin-End: 31-138
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQK
KLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKR
Structures of the domain O15514 31-138
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 D 32-136 None
5iya X-ray 5.4 D 32-136 None
5iy8 X-ray 7.9 D 32-136 None
5iyd X-ray 3.9 D 32-136 None
5iy6 X-ray 7.2 D 32-136 None
5iyc X-ray 3.9 D 32-136 None
5iy9 X-ray 6.3 D 32-136 None
5iyb X-ray 3.9 D 32-136 None


© NPIDB team 2003 - 2019

text