Pfam domain
Pfam family: HhH-GPD (PF00730.27)
Uniprot AC: O15527
RecName: N-glycosylase/DNA lyase
Begin-End: 142-301
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 

Sequence:
FSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHGFPSLQALAGPEVEAHLRKLGL
GYRARYVSASARAILEEQGGLAWLQQLRESSYEEAHKALCILPGVGTKVADCICLMALDK
PQAVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELGN
Structures of the domain O15527 142-301
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1n39 X-ray 2.2 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
1yql X-ray 2.6 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
6w13 X-ray 2.38 A 142-301 None
1ebm X-ray 2.1 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
1m3h X-ray 2.05 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
2i5w X-ray 2.6 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mn 
1lwy X-ray 2.01 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
1hu0 X-ray 2.35 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
1fn7 X-ray 2.6 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
1yqk X-ray 2.5 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
1lww X-ray 2.1 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
1lwv X-ray 2.3 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
1m3q X-ray 1.9 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
6w0r X-ray 2.35 A 142-301 None
1n3c X-ray 2.7 A 142-301  H-Bb H-Mj L-Bb L-Mj L-Mn 
1yqm X-ray 2.5 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
6w0m X-ray 2.37 A 142-301  H-Bb H-Mn L-Bb L-Mj L-Mn 
1n3a X-ray 2.2 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
2nob X-ray 2.1 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
2noh X-ray 2.01 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
3ktu X-ray 2.3 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
2noi X-ray 2.35 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
2xhi X-ray 1.55 A 142-301  H-Bb H-Mn L-Bb L-Mj L-Mn 
3ih7 X-ray 3.1 A 142-301  H-Bb H-Mn L-Bb L-Mj L-Mn 
2nof X-ray 2.35 A 142-301  H-Bb H-Mn L-Bb L-Mj L-Mn 
2noe X-ray 2.2 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
1yqr X-ray 2.43 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
2nol X-ray 2.57 A 142-301  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
2noz X-ray 2.43 A 142-302  H-Bb H-Mn L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text