Pfam domain
Pfam family: OGG_N (PF07934.11)
Uniprot AC: O15527
RecName: N-glycosylase/DNA lyase
Begin-End: 25-141
Organism: Homo sapiens
Interaction Mode:   

Sequence:
SIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTEEQLHCTVYRGDKSQ
ASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDPIECL
Structures of the domain O15527 25-141
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1n39 X-ray 2.2 A 25-141 None
1yql X-ray 2.6 A 25-141 None
1ebm X-ray 2.1 A 25-141 None
1m3h X-ray 2.05 A 25-141 None
2i5w X-ray 2.6 A 25-141 None
2nof X-ray 2.35 A 25-141 None
1lwy X-ray 2.01 A 25-141 None
3ih7 X-ray 3.1 A 25-141 None
1hu0 X-ray 2.35 A 25-141 None
1fn7 X-ray 2.6 A 25-141 None
1yqk X-ray 2.5 A 25-141 None
2nob X-ray 2.1 A 25-141 None
1lww X-ray 2.1 A 25-141 None
3ktu X-ray 2.3 A 25-141 None
1lwv X-ray 2.3 A 25-141 None
1m3q X-ray 1.9 A 25-141 None
1n3c X-ray 2.7 A 25-141 None
1yqm X-ray 2.5 A 25-141 None
1n3a X-ray 2.2 A 25-141 None
2noh X-ray 2.01 A 25-141 None
2noi X-ray 2.35 A 25-141 None
2xhi X-ray 1.55 A 25-141 None
2noe X-ray 2.2 A 25-141 None
1yqr X-ray 2.43 A 25-141 None
2nol X-ray 2.57 A 25-141 None
2noz X-ray 2.43 A 25-141 None


© NPIDB team 2003 - 2019

text