Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: O18473
RecName: Ecdysone receptor
Begin-End: 161-230
Organism: Heliothis virescens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
ELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYICKFGHACEMDIYMRRKCQECRL
KKCLAVGMRP
Structures of the domain O18473 161-230
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4umm X-ray 11.6 E 146-213  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text