Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.18)
Uniprot AC: O20960
RecName: LAGLIDADG endonuclease
Begin-End: 287-390
Organism: Cryphonectria parasitica
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
ISGFASGDSSFNVKISNSPTSLLNKRVQLRFGIGLNIREKALIQYLVAYFDLSDNLKNIY
FDLNSARFEVVKFSDITDKIIPFFDKYSIQGKKSLDYINFKEVA
Structures of the domain O20960 287-390
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yis X-ray 2.89 B 170-272  H-Bb S-Bb S-Mj L-Bb L-Mj 
4yis X-ray 2.89 A 170-272 None


© NPIDB team 2003 - 2020

text