Pfam domain
Pfam family: Exo_endo_phos (PF03372.22)
Uniprot AC: O26314
RecName: Exodeoxyribonuclease
Begin-End: 7-248
Organism: Methanothermobacter thermautotrophicus
Interaction Mode:   

Sequence:
ISWNVNGLRAVHRKGFLKWFMEEKPDILCLQEIKAAPEQLPRKLRHVEGYRSFFTPAERK
GYSGVAMYTKVPPSSLREGFGVERFDTEGRIQIADFDDFLLYNIYFPNGKMSEERLKYKL
EFYDAFLEDVNRERDSGRNVIICGDFNTAHREIDLARPKENSNVSGFLPVERAWIDKFIE
NGYVDTFRMFNSDPGQYTWWSYRTRARERNVGWRLDYFFVNEEFKGKVKRSWILSDVMGS
DH
Structures of the domain O26314 7-248
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3g2c X-ray 2.3 B 8-248 None
3g2c X-ray 2.3 A 8-248 None
3g2d X-ray 2.3 A 8-248 None
3g2d X-ray 2.3 B 8-248 None
3g3y X-ray 2.5 A 8-248 None
3g3y X-ray 2.5 B 8-248 None
3g00 X-ray 1.74 B 8-248 None
3g00 X-ray 1.74 A 8-248 None
3g38 X-ray 3.04 A 8-248 None
3g4t X-ray 2.64 A 8-248 None
3g4t X-ray 2.64 B 8-248 None
3ga6 X-ray 1.9 A 1008-1248 None
3ga6 X-ray 1.9 B 2008-2248 None
3g3c X-ray 3.04 B 8-248 None
3g3c X-ray 3.04 A 8-248 None
3g0r X-ray 2.4 B 8-248 None
3g0r X-ray 2.4 A 8-248 None


© NPIDB team 2003 - 2020

text