Pfam domain
Pfam family: tRNA_anti-codon (PF01336.27)
Uniprot AC: O28025
RecName: tRNA(Ile2) 2-agmatinylcytidine synthetase TiaS
Begin-End: 267-340
Organism: Archaeoglobus fulgidus
Interaction Mode:   

Sequence:
YRLRGRVTLEPYDIEGGHVFFEIDTKFGSVKCAAFEPTKQFRNVIRLLRKGDVVEVYGSM
KKDTINLEKIQIVE
Structures of the domain O28025 267-340
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3amt X-ray 2.9 A 267-340 None
3amu X-ray 3.1 A 267-340 None


© NPIDB team 2003 - 2021

text