Pfam domain
Pfam family: tRNA_NucTransf2 (PF09249.10)
Uniprot AC: O28126
RecName: CCA-adding enzyme
Begin-End: 146-255
Organism: Archaeoglobus fulgidus
Interaction Mode:   

Sequence:
NEVRLLKGFLKANGIYGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAK
GEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLCREFMEAPSLGFFK
Structures of the domain O28126 146-255
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2zh5 X-ray 2.6 A 146-254 None
2zh4 X-ray 2.65 A 146-254 None
2dr9 X-ray 2.8 A 146-254 None
2zh7 X-ray 3 A 146-254 None
2zh6 X-ray 2.5 A 146-254 None
3ovs X-ray 2.8 B 146-254 None
3ovs X-ray 2.8 A 146-254 None
3ova X-ray 1.98 A 146-254 None
2dr8 X-ray 2.5 A 146-254 None
2zhb X-ray 3.05 A 146-254 None
3ouy X-ray 2.69 B 146-254 None
3ouy X-ray 2.69 A 146-254 None
4x4r X-ray 3.2 A 146-254 None
4x4r X-ray 3.2 C 146-254 None
2zh9 X-ray 2.9 A 146-254 None
4x4o X-ray 3.2 C 146-254 None
4x4o X-ray 3.2 A 146-254 None
2zh1 X-ray 2.8 A 146-254 None
2dvi X-ray 2.61 A 146-254 None
1tfw X-ray 2.2 B 146-254 None
1tfw X-ray 2.2 A 146-254 None
1tfw X-ray 2.2 D 146-254 None
1tfw X-ray 2.2 C 146-254 None
1tfy X-ray 3.2 B 146-254 None
1tfy X-ray 3.2 A 146-254 None
1tfy X-ray 3.2 D 146-254 None
1tfy X-ray 3.2 C 146-254 None
2dr7 X-ray 2.8 A 146-254 None
3ovb X-ray 1.95 B 146-254 None
3ovb X-ray 1.95 A 146-254 None
1sz1 X-ray 6.21 B 146-254 None
1sz1 X-ray 6.21 A 146-254 None
2zh8 X-ray 2.65 A 146-254 None
2drb X-ray 2.8 A 146-254 None
3ov7 X-ray 3 B 146-254 None
3ov7 X-ray 3 A 146-254 None
2zh3 X-ray 2.5 A 146-254 None
2zha X-ray 2.95 A 146-254 None
2zh2 X-ray 2.66 A 146-254 None
2dr5 X-ray 2.8 A 146-254 None
2dra X-ray 2.5 A 146-254 None
4x4u X-ray 2.7 C 146-254 None
4x4u X-ray 2.7 F 146-254 None
4x4u X-ray 2.7 E 146-254 None
4x4u X-ray 2.7 A 146-254 None
4x4q X-ray 3.15 A 146-254 None
4x4q X-ray 3.15 C 146-254 None
4x4t X-ray 2.5 F 146-254 None
4x4t X-ray 2.5 E 146-254 None
4x4t X-ray 2.5 C 146-254 None
4x4t X-ray 2.5 A 146-254 None
4x4v X-ray 2.6 C 146-254 None
4x4v X-ray 2.6 A 146-254 None
4x4v X-ray 2.6 C 146-254 None
4x4v X-ray 2.6 A 146-254 None
4x4p X-ray 3 C 146-254 None
4x4p X-ray 3 A 146-254 None
4x4p X-ray 3 E 146-254 None
4x4p X-ray 3 G 146-254 None
4x4p X-ray 3 C 146-254 None
4x4p X-ray 3 A 146-254 None
4x4p X-ray 3 E 146-254 None
4x4p X-ray 3 G 146-254 None
4x4n X-ray 2.95 F 146-254 None
4x4n X-ray 2.95 E 146-254 None
4x4n X-ray 2.95 C 146-254 None
4x4n X-ray 2.95 A 146-254 None
4x4s X-ray 3.25 A 146-254 None
4x4s X-ray 3.25 C 146-254 None


© NPIDB team 2003 - 2019

text