Pfam domain
Pfam family: Hjc (PF01870.20)
Uniprot AC: O28314
RecName: Holliday junction resolvase Hjc
Begin-End: 7-99
Organism: Archaeoglobus fulgidus
Interaction Mode:  S-Bb L-Bb 

Sequence:
RFERDLLVELWKAGFAAIRVAGSGVSPFPCPDIVAGNGRTYLAIEVKMRKELPLYLSADE
VEQLVTFARGFGAEAYVALKLPRKKWRFFPVQM
Structures of the domain O28314 7-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2wiw X-ray 1.8 A 7-99 None
2wiw X-ray 1.8 B 7-99  S-Bb L-Bb 
2wiz X-ray 3.3 A 7-99  L-Bb L-Mn 
2wiz X-ray 3.3 B 7-99 None
2wj0 X-ray 3.1 A 7-99  H-Bb S-Bb 
2wj0 X-ray 3.1 B 7-99  S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text