Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: O29386
RecName: Putative snRNP Sm-like protein
Begin-End: 7-72
Organism: Archaeoglobus fulgidus
Interaction Mode:   

Sequence:
DVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDT
VVFVSP
Structures of the domain O29386 7-72
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1i5l X-ray 2.75 N 8-72 None
1i5l X-ray 2.75 M 8-72 None
1i5l X-ray 2.75 L 8-72 None
1i5l X-ray 2.75 K 8-72 None
1i5l X-ray 2.75 J 8-72 None
1i5l X-ray 2.75 I 8-72 None
1i5l X-ray 2.75 H 8-72 None
1i5l X-ray 2.75 G 8-72 None
1i5l X-ray 2.75 F 8-72 None
1i5l X-ray 2.75 E 8-72 None
1i5l X-ray 2.75 D 8-72 None
1i5l X-ray 2.75 C 8-72 None
1i5l X-ray 2.75 B 8-72 None
1i5l X-ray 2.75 A 8-72 None


© NPIDB team 2003 - 2019

text