Pfam domain
Pfam family: Exo_endo_phos (PF03372.22)
Uniprot AC: O29675
RecName: Exodeoxyribonuclease III (XthA)
Begin-End: 5-248
Organism: Archaeoglobus fulgidus
Interaction Mode:  H-Bb L-Bb L-Mj L-Mn 

Sequence:
ATFNVNSIRSRLHIVIPWLKENKPDILCMQETKVENRKFPEADFHRIGYHVVFSGSKGRN
GVAIASLEEPEDVSFGLDSEPKDEDRLIRAKIAGIDVINTYVPQGFKIDSEKYQYKLQWL
ERLYHYLQKTVDFRSFAVWCGDMNVAPEPIDVHSPDKLKNHVCFHEDARRAYKKILELGF
VDVLRKIHPNERIYTFYDYRVKGAIERGLGWRVDAILATPPLAERCVDCYADIKPRLAEK
PSDH
Structures of the domain O29675 5-248
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2voa X-ray 1.7 B 5-248 None
2voa X-ray 1.7 A 5-248 None
2voa X-ray 1.7 B 5-248  H-Bb L-Bb L-Mj L-Mn 
2voa X-ray 1.7 A 5-248  H-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2020

text