Pfam domain
Pfam family: EXOSC1 (PF10447.8)
Uniprot AC: O30033
RecName: Exosome complex component Csl4
Begin-End: 52-172
Organism: Archaeoglobus fulgidus
Interaction Mode:   

Sequence:
IPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEA
VGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKIS
T
Structures of the domain O30033 52-172
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3m7n X-ray 2.4 B 52-172 None
3m7n X-ray 2.4 C 52-172 None
3m7n X-ray 2.4 A 52-172 None
3m85 X-ray 3 C 52-172 None
3m85 X-ray 3 B 52-172 None
3m85 X-ray 3 A 52-172 None


© NPIDB team 2003 - 2019

text