Pfam domain
Pfam family: tRNA-synt_2d (PF01409.19)
Uniprot AC: O30126
RecName: O-phosphoserine--tRNA(Cys) ligase
Begin-End: 102-355
Organism: Archaeoglobus fulgidus
Interaction Mode:   

Sequence:
KPNVGISAEKIRQIEAITKREVDSKPLQEIFHRYKKGEIDGDDLSYLIAEVLDVDDITAV
KILDEVFPEFKELKPISSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREQGE
DATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFENFRFRKDEKRSKYYIPDTQTE
VFAFHPKLVGSSTKYSDGWIEIATFGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYD
DVRKMVYPQIHGEI
Structures of the domain O30126 102-355
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2du3 X-ray 2.6 A 107-351 None
2du3 X-ray 2.6 B 44-351 None
2du4 X-ray 2.8 B 44-351 None
2du4 X-ray 2.8 A 44-351 None
2du5 X-ray 3.2 B 44-351 None
2du5 X-ray 3.2 A 107-351 None
2du6 X-ray 3.3 B 44-351 None
2du6 X-ray 3.3 A 107-351 None


© NPIDB team 2003 - 2019

text