Pfam domain
Pfam family: RpoY (PF07288.13)
Uniprot AC: O31718
RecName: DNA-directed RNA polymerase subunit epsilon
Begin-End: 2-60
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
IYKVFYQEKADEVPVREKTDSLYIEGVSERDVRTKLKEKKFNIEFITPVDGAFLEYEQQ
Structures of the domain O31718 2-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7ckq X-ray 4.4 H 2-60 None


© NPIDB team 2003 - 2021

text