Pfam domain
Pfam family: Ribosomal_L19 (PF01245.19)
Uniprot AC: O31742
RecName: 50S ribosomal protein L19
Begin-End: 3-113
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
KLIEDITKEQLRTDLPAFRPGDTLRVHVKVVEGNRERIQIFEGVVIKRRGGGISETFTVR
KISYGVGVERTFPVHTPKIAKIEVVRYGKVRRAKLYYLRELRGKAARIKEI
Structures of the domain O31742 3-113
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j3v X-ray 13.3 P 4-112 None
3j3w X-ray 10.7 P 4-112 None


© NPIDB team 2003 - 2019

text