Pfam domain
Pfam family: Ribosomal_L32p (PF01783.22)
Uniprot AC: O34687
RecName: 50S ribosomal protein L32
Begin-End: 2-56
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
AVPFRRTSKMKKRLRRTHFKLNVPGMTECPSCGEMKLSHRVCKACGSYNGKDINV
Structures of the domain O34687 2-56
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j3v X-ray 13.3 0 2-54 None
3j3w X-ray 10.7 0 2-54 None


© NPIDB team 2003 - 2019

text