Pfam domain
Pfam family: DNA_ligase_OB_2 (PF14743.5)
Uniprot AC: O41026
RecName: ATP-dependent DNA ligase
Begin-End: 225-293
Organism: Paramecium bursaria Chlorella virus 1
Interaction Mode:  H-Bb S-Bb S-Mn L-Mn 

Sequence:
SGKVEEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCP
RFPVFIGIR
Structures of the domain O41026 225-293
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2q2t X-ray 2.3 A 230-293  H-Bb S-Bb S-Mn 
2q2u X-ray 3 A 230-293  H-Bb S-Bb L-Mn 
2q2u X-ray 3 B 230-293  H-Bb S-Bb L-Mn 
2q2u X-ray 3 C 230-293  H-Bb S-Bb L-Mn 
2q2u X-ray 3 D 230-293  H-Bb S-Bb L-Mn 


© NPIDB team 2003 - 2019

text