Pfam domain
Pfam family: DNA_ligase_A_M (PF01068.20)
Uniprot AC: O41026
RecName: ATP-dependent DNA ligase
Begin-End: 6-188
Organism: Paramecium bursaria Chlorella virus 1
Interaction Mode:  S-Bb L-Bb 

Sequence:
PLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSD
GEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPH
ILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILL
KMK
Structures of the domain O41026 6-188
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2q2t X-ray 2.3 A 7-177  S-Bb L-Bb 
2q2u X-ray 3 A 7-177  L-Bb 
2q2u X-ray 3 B 7-177  L-Bb 
2q2u X-ray 3 C 7-177  L-Bb 
2q2u X-ray 3 D 7-177  L-Bb 


© NPIDB team 2003 - 2019

text