Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: O42661
RecName: Small nuclear ribonucleoprotein Sm D1
Begin-End: 5-70
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
RFLMKLTNETVSIELKNGTIVHGTITSVDMQMNTHLKAVKMTVKGREPVPVETLSIRGNN
IRYYIL
Structures of the domain O42661 5-70
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jb9 X-ray 3.6 f 5-69 None
3jb9 X-ray 3.6 F 5-69 None


© NPIDB team 2003 - 2019

text