Pfam domain
Pfam family: WD40 (PF00400.31)
Uniprot AC: O43172
RecName: U4/U6 small nuclear ribonucleoprotein Prp4
Begin-End: 215-259
Organism: Homo sapiens
Interaction Mode:   

Sequence:
HKSLRSLNNFCSQIGDDRPISYCHFSPNSKMLATACWSGLCKLWS
Structures of the domain O43172 215-259
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o9z X-ray 4.5 F 263-308 None


© NPIDB team 2003 - 2019

text