Pfam domain
Pfam family: WD40 (PF00400.31)
Uniprot AC: O43172
RecName: U4/U6 small nuclear ribonucleoprotein Prp4
Begin-End: 263-309
Organism: Homo sapiens
Interaction Mode:   

Sequence:
CNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWS
Structures of the domain O43172 263-309
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 L 264-309 None


© NPIDB team 2003 - 2019

text