Pfam domain
Pfam family: WD40 (PF00400.31)
Uniprot AC: O43172
RecName: U4/U6 small nuclear ribonucleoprotein Prp4
Begin-End: 313-351
Organism: Homo sapiens
Interaction Mode:   

Sequence:
DEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLWD
Structures of the domain O43172 313-351
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 L 397-435 None
3jcr X-ray 7 L 482-519 None
5o9z X-ray 4.5 F 481-518 None
5o9z X-ray 4.5 F 396-434 None


© NPIDB team 2003 - 2019

text