Pfam domain
Pfam family: SART-1 (PF03343.12)
Uniprot AC: O43290
RecName: U4/U6.U5 tri-snRNP-associated protein 1
Begin-End: 142-307
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KEAGTKEEPVTADVINPMALRQREELREKLAAAKEKRLLNQKLGKIKTLGEDDPWLDDTA
AWIERSRQLQKEKDLAEKRAKLLEEMDQEFGVSTLVEEEFGQRRQDLYSARDLQGLTVEH
AIDSFREGETMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELR
Structures of the domain O43290 142-307
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o9z X-ray 4.5 P 21-98 None


© NPIDB team 2003 - 2019

text