Pfam domain
Pfam family: PRP3 (PF08572.9)
Uniprot AC: O43395
RecName: U4/U6 small nuclear ribonucleoprotein Prp3
Begin-End: 438-521
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVE
AHVRAQMAKRQKAHEEANAARKLT
Structures of the domain O43395 438-521
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o9z X-ray 4.5 E 4-521 None


© NPIDB team 2003 - 2019

text