Pfam domain
Pfam family: DUF1115 (PF06544.11)
Uniprot AC: O43395
RecName: U4/U6 small nuclear ribonucleoprotein Prp3
Begin-End: 544-673
Organism: Homo sapiens
Interaction Mode:   

Sequence:
SVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIK
WDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKK
HGAEHYWDLA
Structures of the domain O43395 544-673
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 K 545-673 None


© NPIDB team 2003 - 2019

text