Pfam domain
Pfam family: T-box (PF00907.21)
Uniprot AC: O43435
RecName: T-box transcription factor TBX1
Begin-End: 112-297
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 

Sequence:
VQLEMKALWDEFNQLGTEMIVTKAGRRMFPTFQVKLFGMDPMADYMLLMDFVPVDDKRYR
YAFHSSSWLVAGKADPATPGRVHYHPDSPAKGAQWMKQIVSFDKLKLTNNLLDDNGHIIL
NSMHRYQPRFHVVYVDPRKDSEKYAEENFKTFVFEETRFTAVTAYQNHRITQLKIASNPF
AKGFRD
Structures of the domain O43435 112-297
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4a04 X-ray 2.58 A 112-297  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 
4a04 X-ray 2.58 B 112-297  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text