Pfam domain
Pfam family: Pro_isomerase (PF00160.20)
Uniprot AC: O43447
RecName: Peptidyl-prolyl cis-trans isomerase H
Begin-End: 14-176
Organism: Homo sapiens
Interaction Mode:   

Sequence:
FFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFM
IQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDW
LDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE
Structures of the domain O43447 14-176
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o9z X-ray 4.5 M 19-175 None


© NPIDB team 2003 - 2019

text