Pfam domain
Pfam family: Forkhead (PF00250.17)
Uniprot AC: O43524
RecName: Forkhead box protein O3
Begin-End: 158-244
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb 

Sequence:
GNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLH
SRFMRVQNEGTGKSSWWIINPDGGKSG
Structures of the domain O43524 158-244
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2uzk X-ray 2.7 A 159-239  H-Bb H-Mj S-Bb 
2uzk X-ray 2.7 C 1159-1239  H-Bb H-Mj S-Bb 


© NPIDB team 2003 - 2020

text