Pfam domain
Pfam family: ORC4_C (PF14629.8)
Uniprot AC: O43929
RecName: Origin recognition complex subunit 4
Begin-End: 228-415
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLAL
NRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQ
MVYNEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLD
NTQIMNAL
Structures of the domain O43929 228-415
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7jps X-ray 4.4 D 228-415 None


© NPIDB team 2003 - 2021

text