Pfam domain
Pfam family: AAA_16 (PF13191.8)
Uniprot AC: O43929
RecName: Origin recognition complex subunit 4
Begin-End: 36-190
Organism: Homo sapiens
Interaction Mode:   

Sequence:
NLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVL
QVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVI
FILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVI
Structures of the domain O43929 36-190
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7jps X-ray 4.4 D 36-190 None


© NPIDB team 2003 - 2021

text