Pfam domain
Pfam family: Ribosomal_S6e (PF01092.18)
Uniprot AC: O44012
RecName: 40S ribosomal protein S6
Begin-End: 1-129
Organism: Leishmania infantum
Interaction Mode:   

Sequence:
MYLNIAYPRNGTVKQFEISDEVLRRVQLQDYRLGNEVDGAIFGSEFKGYIFRLRGGSDKD
GFPMVPGVLASSRVSLLVKRGAIGFNTFRGYQGERRRKNVRGCVLASDIALVNVTISKVG
DQPIEGVTD
Structures of the domain O44012 1-129
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 G 1-129 None


© NPIDB team 2003 - 2019

text