Pfam domain
Pfam family: tRNA-synt_1 (PF00133.21)
Uniprot AC: O58698
RecName: Leucine--tRNA ligase
Begin-End: 12-690
Organism: Pyrococcus horikoshii
Interaction Mode:   

Sequence:
KWQKRWLEAKIFEPNIRDKPKEKKFYITVAFPYLSGHLHVGHARTYTIPDVIARFKRMQG
YNVLFPMAWHITGSPIVGIAERIKNRDPKTIWIYRDVYKVPEEILWTFEDPINIVKYFMK
AAKETFIRAGFSVDWSREFYTTSLFPPFSKFIEWQFWKLKEKGYIVKGAHRVRWDPVVGT
PLGDHDLMEGEDVPILDYIIIKFELRENGEVIYLPAATLRPETVYGVTNMWVNPNATYVK
AKVRRKDKEETWIVSKEAAYKLSFQDREIEVIEEFKGEKLIGKYVRNPVSGDEVIILPAE
FVDPDNATGVVMSVPAHAPFDHVALEDLKRETEILEKYDIDPRIVENITYISLIKLEGYG
DFPAVEEVNKLGIKSQKDKEKLEQATKTIYKAEYHKGIFKVPPYEGKPVQEVKEAIAKEM
LEKGIAEIMYEFAEKNVISRFGNRAVIKIIHDQWFIDYGNPEWKEKARKALERMKILPET
RRAQFEAIIDWLDKKACARKIGLGTPLPWDPEWVIESLSDSTIYMAYYTISRHINKLRQE
GKLDPEKLTPEFFDYIFLEEFSEDKEKELEKKTGIPAEIIHEMKEEFEYWYPLDWRCSGK
DLIPNHLTFFIFNHVAIFREEHWPKGIAVNGFGTLEGQKMSKSKGNVLNFIDAIEENGAD
VVRLYIMSLAEHDSDFDWR
Structures of the domain O58698 12-690
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1wz2 X-ray 3.21 A 12-689 None
1wz2 X-ray 3.21 B 12-689 None


© NPIDB team 2003 - 2019

text