Pfam domain
Pfam family: Anticodon_1 (PF08264.12)
Uniprot AC: O58698
RecName: Leucine--tRNA ligase
Begin-End: 726-863
Organism: Pyrococcus horikoshii
Interaction Mode:   

Sequence:
DRWMLHRLNKAIKETTNALEEFRTRTAVQWAFYSIMNDLRWYLRRTEGRDDEAKRYVLRT
LADVWVRLMAPFTPHICEELWEKLGGEGFVSLAKWPEPVEEWWNETIEAEEEFIRSVMED
IKEIIEVAKIENAKRAYI
Structures of the domain O58698 726-863
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1wz2 X-ray 3.21 A 726-859 None
1wz2 X-ray 3.21 B 726-859 None


© NPIDB team 2003 - 2019

text