Pfam domain
Pfam family: PUA (PF01472.19)
Uniprot AC: O58843
RecName: tRNA-guanine(15) transglycosylase
Begin-End: 508-581
Organism: Pyrococcus horikoshii
Interaction Mode:   

Sequence:
MRVVVNKEAEPFARKGKDVFAKFVIFADPGIRPYDEVLVVNENDELLATGQALLSGREMI
VFQYGRAVKVRKGV
Structures of the domain O58843 508-581
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1j2b X-ray 3.3 A 509-579 None
1j2b X-ray 3.3 B 509-579 None


© NPIDB team 2003 - 2019

text