Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: O59734
RecName: Small nuclear ribonucleoprotein F
Begin-End: 10-75
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
PFLQGLIGKPVLVRLKWGQEYKGTLQSVDSYMNLQLLNAEELVDGVKTGDLGEILIRCNN
VLWVGE
Structures of the domain O59734 10-75
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jb9 X-ray 3.6 n 11-74 None
3jb9 X-ray 3.6 I 11-74 None


© NPIDB team 2003 - 2019

text