Pfam domain
Pfam family: Rad21_Rec8 (PF04824.18)
Uniprot AC: O60216
RecName: Double-strand-break repair protein rad21 homolog
Begin-End: 574-628
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIATPGPRF
Structures of the domain O60216 574-628
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wg3 X-ray 5.3 C 574-628 None
6wge X-ray 3.9 C 574-628 None


© NPIDB team 2003 - 2021

text