Pfam domain
Pfam family: SNF2-rel_dom (PF00176.25)
Uniprot AC: O60264
RecName: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
Begin-End: 183-463
Organism: Homo sapiens
Interaction Mode:   

Sequence:
YQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLH
NWMSEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNW
RYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSA
DDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQRE
WYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLF
Structures of the domain O60264 183-463
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ne3 X-ray 3.9 W 183-463  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text