Pfam domain
Pfam family: Helicase_C (PF00271.33)
Uniprot AC: O60264
RecName: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
Begin-End: 483-597
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSI
NAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIG
Structures of the domain O60264 483-597
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ne3 X-ray 3.9 W 483-597  H-Bb S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text