Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: O60814
RecName: Histone H2B type 1-K
Begin-End: 32-102
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
RSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTIT
SREIQTAVRLL
Structures of the domain O60814 32-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2cv5 X-ray 2.5 H 29-97  H-Bb S-Bb L-Bb 
2cv5 X-ray 2.5 D 27-97  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text