Pfam domain
Pfam family: Sigma54_CBD (PF04963.12)
Uniprot AC: O66858
RecName: RNA polymerase sigma factor RpoN
Begin-End: 73-233
Organism: Aquifex aeolicus
Interaction Mode:   

Sequence:
ELEELQQNIKLELEGKEQELALELLNYLNEKGFLSKSVEEISDVLRCSVEELEKVRQKVL
RLEPLGVCSKDVWEFLELQIEEIYPEEEEILKKALRDLKRGKKLKPEIKGKLSRLRLFPL
SSSAEKVYTFAKVDAIIEEENGEFFIYLYEDFIDIDLNEEY
Structures of the domain O66858 73-233
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ui5 X-ray 3.4 I 75-174 None
5ui5 X-ray 3.4 V 75-174 None


© NPIDB team 2003 - 2019

text