Pfam domain
Pfam family: Anticodon_1 (PF08264.12)
Uniprot AC: O67298
RecName: Methionine--tRNA ligase
Begin-End: 375-493
Organism: Aquifex aeolicus
Interaction Mode:   

Sequence:
DEEYAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYLNKYVDEKQPWALNKERKKEELQ
KVLYALVDGLFVLTHLLYPITPNKMKEALQMLGEKEFLKELKPYSKNTYKLGERKILFP
Structures of the domain O67298 375-493
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2csx X-ray 2.7 B 382-480 None
2csx X-ray 2.7 A 382-480 None
2ct8 X-ray 2.7 B 382-480 None
2ct8 X-ray 2.7 A 382-480 None


© NPIDB team 2003 - 2019

text