Pfam domain
Pfam family: Piwi (PF02171.16)
Uniprot AC: O67434
RecName: Uncharacterized protein
Begin-End: 419-694
Organism: Aquifex aeolicus
Interaction Mode:   

Sequence:
LVIVFLEEYPKVDPYKSFLLYDFVKRELLKKMIPSQVILNRTLKNENLKFVLLNVAEQVL
AKTGNIPYKLKEIEGKVDAFVGIDISRITRDGKTVNAVAFTKIFNSKGELVRYYLTSYPA
FGEKLTEKAIGDVFSLLEKLGFKKGSKIVVHRDGRLYRDEVAAFKKYGELYGYSLELLEI
IKRNNPRFFSNEKFIKGYFYKLSEDSVILATYNQVYEGTHQPIKVRKVYGELPVEVLCSQ
ILSLTLMNYSSFQPIKLPATVHYSDKITKLMLRGIE
Structures of the domain O67434 419-694
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2f8s X-ray 3 B 420-692 None
2f8s X-ray 3 A 420-692 None
2f8t X-ray 3.1 B 420-692 None
2f8t X-ray 3.1 A 420-692 None


© NPIDB team 2003 - 2020

text