Pfam domain
Pfam family: KH_2 (PF07650.16)
Uniprot AC: O67800
RecName: GTPase Era
Begin-End: 209-288
Organism: Aquifex aeolicus
Interaction Mode:   

Sequence:
EVPTSIAVKINEIKPGDANPNMLVIKGEIIVDRENLKPIIIGKKGQRLKEIGKRARQELE
LILGRPVYLELWVKVVPDWR
Structures of the domain O67800 209-288
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3iev X-ray 1.9 A 209-288 None
3r9w X-ray 2.05 A 209-288 None
3r9w X-ray 2.05 A 209-288 None
3r9x X-ray 2.8 A 209-288 None


© NPIDB team 2003 - 2019

text