Pfam domain
Pfam family: HTH_1 (PF00126.29)
Uniprot AC: O68014
RecName: HTH-type transcriptional regulator BenM
Begin-End: 3-62
Organism: Acinetobacter baylyi
Interaction Mode:   

Sequence:
LRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGH
Structures of the domain O68014 3-62
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4iht X-ray 3 D 3-62  H-Bb H-Mj L-Bb L-Mj 
4iht X-ray 3 C 3-62  H-Bb H-Mj L-Bb L-Mj L-Mn 
4iht X-ray 3 B 3-62  H-Bb H-Mj L-Bb L-Mj 
4iht X-ray 3 A 3-62  H-Bb H-Mj L-Bb L-Mj L-Mn 
4ihs X-ray 3.1 A 3-62  H-Bb H-Mj L-Bb L-Mj L-Mn 
4ihs X-ray 3.1 B 3-62  H-Bb H-Mj L-Bb L-Mj L-Mn 
4ihs X-ray 3.1 D 3-62  H-Bb H-Mj L-Bb L-Mj L-Mn 
4ihs X-ray 3.1 C 3-62  H-Bb H-Mj L-Bb L-Mj L-Mn 
4ihs X-ray 3.1 D 3-62  H-Bb H-Mj L-Bb L-Mj L-Mn 
4ihs X-ray 3.1 C 3-62  H-Bb H-Mj L-Bb L-Mj L-Mn 
4ihs X-ray 3.1 B 3-62  H-Bb H-Mj L-Bb L-Mj L-Mn 
4ihs X-ray 3.1 A 3-62  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text