Pfam domain
Pfam family: Endonuc_BglI (PF14562.8)
Uniprot AC: O68557
RecName: Type-2 restriction enzyme BglI
Begin-End: 8-294
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
KIFMSYNQNKQYLEDNPEIQEKIELYGLNLLNEVISDNEEEIRADYNEANFLHPFWMNYP
PLDRGKMPKGDQIPWIEVGEKAVGSKLTRLVSQREDITVREIGLPTGPDERYLLTSPTIY
SLTNGFTDSIMMFVDIKSVGPRDSDYDLVLSPNQVSGNGDWAQLEGGIQNNQQTIQGPRS
SQIFLPTIPPLYILSDGTIAPVVHLFIKPIYAMRSLTKGDTGQSLYKIKLASVPNGLGLF
CNPGYAFDSAYKFLFRPGKDDRTKSLLQKRVRVDLRVLDKIGPRVMT
Structures of the domain O68557 8-294
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1dmu X-ray 2.2 A 8-294 None


© NPIDB team 2003 - 2021

text