Pfam domain
Pfam family: Phage_integrase (PF00589.24)
Uniprot AC: O68847
RecName: Integrase
Begin-End: 104-308
Organism: Vibrio cholerae
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 

Sequence:
VVLTRDEIRRLLEIVDPKHQLPIKLLYGSGLRLMECMRLRVQDIDFDYGAIRIWQGKGGK
NRTVTLAKELYPHLKEQIALAKRYYDRDLHQKNYGGVWLPTALKEKYPNAPYEFRWHYLF
PSFQLSLDPESDVMRRHHMNETVLQKAVRRSAQEAGIEKTVTCHTLRHSFATHLLEVGAD
IRTVQEQLGHTDVKTTQIYTHVLDR
Structures of the domain O68847 104-308
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2a3v X-ray 2.8 C 104-311  H-Bb H-Mj H-Mn L-Bb L-Mn 
2a3v X-ray 2.8 D 104-308  H-Bb H-Mj S-Bb L-Bb L-Mj 
2a3v X-ray 2.8 B 104-308  H-Bb H-Mj S-Bb L-Bb L-Mj 
2a3v X-ray 2.8 A 104-313  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2021

text