Pfam domain
Pfam family: Phage_int_SAM_4 (PF13495.8)
Uniprot AC: O68847
RecName: Integrase
Begin-End: 5-89
Organism: Vibrio cholerae
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
FLLSVREFMQTRYYAKKTIEAYLHWITRYIHFHNKKHPSLMGDKEVEEFLTYLAVQGKVA
TKTQSLALNSLSFLYKEILKTPLSL
Structures of the domain O68847 5-89
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2a3v X-ray 2.8 C 5-89  H-Bb H-Mj L-Bb 
2a3v X-ray 2.8 D 5-89  H-Bb H-Mj L-Bb 
2a3v X-ray 2.8 B 5-89  H-Bb H-Mj L-Bb 
2a3v X-ray 2.8 A 5-89  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text