Pfam domain
Pfam family: PTS-HPr (PF00381.18)
Uniprot AC: O69250
RecName: Phosphocarrier protein HPr
Begin-End: 2-83
Organism: Bacillus megaterium
Interaction Mode:   

Sequence:
AQKTFTVTADSGIHARPATTLVQAASKFDSDINLEFNGKTVNLKSIMGVMSLGIQKGATI
TISAEGSDEADALAALEDTMSK
Structures of the domain O69250 2-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1rzr X-ray 2.8 T 3-81 None
1rzr X-ray 2.8 L 3-81 None
1rzr X-ray 2.8 Y 3-81 None
1rzr X-ray 2.8 S 3-81 None


© NPIDB team 2003 - 2019

text